PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_015895-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family NF-YB
Protein Properties Length: 139aa    MW: 15841.7 Da    PI: 4.4664
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_015895-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB130.94.3e-415752797
          NF-YB 27 iskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                   +skdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++tlGfe+yv+plk+yl+kyre+egek
  NNU_015895-RA  5 VSKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAISTLGFENYVNPLKLYLQKYREMEGEK 75
                   89******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008083.7E-18349IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471137.58E-31494IPR009072Histone-fold
Gene3DG3DSA:1.10.20.107.4E-39498IPR009072Histone-fold
PRINTSPR006152.8E-211331No hitNo description
PROSITE patternPS0068501632IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.8E-213250No hitNo description
PRINTSPR006152.8E-215169No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MVEMVSKDAK ETVQECVSEF ISFVTGEASD KCQREKRKTI NGDDIIWAIS TLGFENYVNP  60
LKLYLQKYRE MEGEKLNVPK QQQEQQVASS DNVNSSAHLT SQPSLLYSTN QPFSMPFSPS  120
SIQQQMQQQE PNDSLGQWL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-335702893NF-YB
4awl_B3e-335702994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-335702994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270446.14e-96PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotQ9SIT91e-48NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBLA0A0V0HN483e-61A0A0V0HN48_SOLCH; Putative nuclear transcription factor Y subunit B-7-like
STRINGPGSC0003DMT4000431762e-59(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G13570.11e-45nuclear factor Y, subunit B7